Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human Interleukin-37/IL-37

    Recombinant Human Interleukin-37/IL-37

    Share:

    Recombinant Human Interleukin-37/IL-37

    Roll over image to zoom in

       

    Product code: 32-7062

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   10 µg

    •  50 µg

    • $319.00 

    • $573.00  $458.40 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • More
    • Review   (0)
    Amount : 50 µg
    Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4.
    Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
    AA sequence : MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
    Gene : IL37
    Gene ID : 27178
    Uniprot ID : Q9NZH6

    Source: E.coli.
    MW :18.7kD.
    Recombinant Human Interleukin-37 is produced by our E.coli expression system and the target gene encoding Lys53-Asp218 is expressed. Human Interleukin family 1 Member 7 (IL1F7) is a member of the Interleukin 1 cytokine family. Five alternatively spliced transcript variants encoding distinct isoforms have been reported with distinct expression profiles. The longest IL1F7 transcript, referred to as IL1F7b or IL1F7 isoform 1, encodes a 218 amino acid residues proprotein containing a 45 amino acid propeptide, which is cleaved to generate mature protein. IL1F7b binds to IL18 Ra with low affinity but does not exert any IL18 agonistic or antagonistic effects. IL1F7b also binds interleukin 18 binding protein (IL-18BP), an inhibitory binding protein of interleukin 18 (IL-18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL-18.

    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
    Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    Subcellular location: Cytoplasm, Nucleus, Secreted
    Post transnational modification: Proteolytically converted to the mature form by CASP1.
    Tissue Specificity: In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.
    BioGrid: 118054. 12 interactions.
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    Monoclonal Antibody to Rat NKp46 (Clone: WEN23)

    Monoclonal Antibody to Rat NKp...

    details-Monoclonal Antibody to Rat NKp46 (Clone: WEN23)
    Recombinant Human LIN28B

    Recombinant Human LIN28B

    details-Recombinant Human LIN28B
    Anti-Mouse CD2 Low Endotoxin Antibody (Clone : RM2-5)

    Anti-Mouse CD2 Low Endotoxin A...

    details-Anti-Mouse CD2 Low Endotoxin Antibody (Clone : RM2-5)
    Monoclonal Antibody to mouse MD-1 (Clone : MD113)

    Monoclonal Antibody to mouse M...

    details-Monoclonal Antibody to mouse MD-1 (Clone : MD113)
    Recombinant Anti-SARS-CoV-2 Spike RBD antibody (CR3022)

    Recombinant Anti-SARS-CoV-2 Sp...

    details-Recombinant Anti-SARS-CoV-2 Spike RBD antibody (CR3022)
    OSGEP Recombinant Protein

    OSGEP Recombinant Protein

    details-OSGEP Recombinant Protein
    SARS Associated Coronavirus Nucleocaspid

    SARS Associated Coronavirus Nu...

    details-SARS Associated Coronavirus Nucleocaspid
    Recombinant Human VEGF-A/VEGF165

    Recombinant Human VEGF-A/VEGF1...

    details-Recombinant Human VEGF-A/VEGF165
    mCD73 Stable Cell Line

    mCD73 Stable Cell Line

    details-mCD73 Stable Cell Line
    oProlactin Recombinant Protein

    oProlactin Recombinant Protein

    details-oProlactin Recombinant Protein
    Anti-CD370 PE (Clone : 8F9)

    Anti-CD370 PE (Clone : 8F9)

    details-Anti-CD370 PE (Clone : 8F9)
    CpG ODN (1668), TLR9 ligand (Class B)

    CpG ODN (1668), TLR9 ligand (C...

    details-CpG ODN (1668), TLR9 ligand (Class B)
    Recombinant Human Nephrosis 2 Idiopathic Steroid-Resistant

    Recombinant Human Nephrosis 2 ...

    details-Recombinant Human Nephrosis 2 Idiopathic Steroid-Resistant
    Anti-CTLA-4 antibody(DM51), Rabbit mAb

    Anti-CTLA-4 antibody(DM51), Ra...

    details-Anti-CTLA-4 antibody(DM51), Rabbit mAb

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Human RAB8, Member RAS Oncogene Family

    Recombinant Human RAB8, Member RAS Oncogene Family

    OPG Recombinant Protein

    OPG Recombinant Protein

    Recombinant Human Junctional Sarcoplasmic Reticulum Protein 1

    Recombinant Human Junctional Sarcoplasmic Reticulum Protein 1

    New Products

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    close

    Please Login to write a Review !!


    close

    Recombinant Human Interleukin-37/IL-37

    Product code: 32-7062
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart