Recombinant Human Interleukin-37/IL-37
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM DTT, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD |
Source: E.coli.
MW :18.7kD.
Recombinant Human Interleukin-37 is produced by our E.coli expression system and the target gene encoding Lys53-Asp218 is expressed. Human Interleukin family 1 Member 7 (IL1F7) is a member of the Interleukin 1 cytokine family. Five alternatively spliced transcript variants encoding distinct isoforms have been reported with distinct expression profiles. The longest IL1F7 transcript, referred to as IL1F7b or IL1F7 isoform 1, encodes a 218 amino acid residues proprotein containing a 45 amino acid propeptide, which is cleaved to generate mature protein. IL1F7b binds to IL18 Ra with low affinity but does not exert any IL18 agonistic or antagonistic effects. IL1F7b also binds interleukin 18 binding protein (IL-18BP), an inhibitory binding protein of interleukin 18 (IL-18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL-18.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Secreted |
| Post transnational modification: | Proteolytically converted to the mature form by CASP1. |
| Tissue Specificity: | In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart. |
| BioGrid: | 118054. 12 interactions. |
|
There are currently no product reviews
|












.png)










