Recombinant Human L-Selectin/CD62L (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 2mM CaCl2, 2mM MgCl2, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNVDHHHHHH |
Source: Human Cells.
MW :34kD.
Recombinant Human L-selectin /sell is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus. SELL contains one C-type lectin domain, one EGF-like domain and two Sushi (CCP/SCR) domains. SELL is expressed in B-cell lines and T-lymphocytes. SELL functions as a cell surface adhesion protein and mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. In addition, SELL also promotes initial tethering and rolling of leukocytes in endothelia.
MW :34kD.
Recombinant Human L-selectin /sell is produced by our Mammalian expression system and the target gene encoding Trp39-Asn332 is expressed with a 6His tag at the C-terminus. SELL contains one C-type lectin domain, one EGF-like domain and two Sushi (CCP/SCR) domains. SELL is expressed in B-cell lines and T-lymphocytes. SELL functions as a cell surface adhesion protein and mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. In addition, SELL also promotes initial tethering and rolling of leukocytes in endothelia.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Expressed in B-cell lines and T-lymphocytes. |
| BioGrid: | 112302. 13 interactions. |
|
There are currently no product reviews
|















.png)







