Recombinant Human N-myc Downstream Regulated Gene 1/NDRG1/DRG-1CAP43 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHTYRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTKTTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC |
Source: E.coli.
MW :45kD.
Recombinant Human NDRG1 is produced by our E.coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus. Protein NDRG1 is a member of the N-Myc Downregulated Gene family, which is part of the a/ beta Hydrolase superfamily. Protein NDRG1 is a cytoplasmic protein that is involved in stress responses, hormone responses, cell growth and differentiation. Protein NDRG1 is necessary for p53-mediated caspase activation and apoptosis. Protein NDRG1 mutuations are reported to be the cause for hereditary motor and sensory neuropathy-Lom. Decreased NDRG1 expression in glioma is linked to tumor progression; overexpression of NDRG1 is connected to malignant status of esophageal cancer.
MW :45kD.
Recombinant Human NDRG1 is produced by our E.coli expression system and the target gene encoding Met1-Cys394 is expressed with a 6His tag at the N-terminus. Protein NDRG1 is a member of the N-Myc Downregulated Gene family, which is part of the a/ beta Hydrolase superfamily. Protein NDRG1 is a cytoplasmic protein that is involved in stress responses, hormone responses, cell growth and differentiation. Protein NDRG1 is necessary for p53-mediated caspase activation and apoptosis. Protein NDRG1 mutuations are reported to be the cause for hereditary motor and sensory neuropathy-Lom. Decreased NDRG1 expression in glioma is linked to tumor progression; overexpression of NDRG1 is connected to malignant status of esophageal cancer.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cytoplasm, Nucleus, Cell membrane |
| Post transnational modification: | Under stress conditions, phosphorylated in the C-terminal on many serine and threonine residues. Phosphorylated in vitro by PKA. Phosphorylation enhanced by increased intracellular cAMP levels. Homocysteine induces dephosphorylation. Phosphorylation by SGK1 is cell cycle dependent. |
| Tissue Specificity: | Ubiquitous; expressed most prominently in placental membranes and prostate, kidney, small intestine, and ovary tissues. Also expressed in heart, brain, skeletal muscle, lung, liver and pancreas. Low levels in peripheral blood leukocytes and in tissues of the immune system. Expressed mainly in epithelial cells. Also found in Schwann cells of peripheral neurons. Reduced expression in adenocarcinomas compared to normal tissues. In colon, prostate and placental membranes, the cells that border the lumen show the highest expression. |
| BioGrid: | 115669. 111 interactions. |
|
There are currently no product reviews
|










.png)








