Recombinant Human Neuronal Acetylcholine Receptor Subunit beta-3/CHRNB3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | IAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLLDHHHHHH |
Source: Human Cells.
MW :25.3kD.
Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed with a 6His tag at the C-terminus. Neuronal acetylcholine receptor subunit beta-3(CHRNB3) is a cell membrane protein and belongs to the ligand-gated ion channel (TC 1.A.9) family. CHRNB3 seems to be composed of two different type of subunits: alpha and beta. The CHRNB3 are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of CHRNB3 are encoded by separate genes and have different primary structure. There are several subtypes of neuronal CHRNB3 that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if like muscle alpha-1, they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits.
MW :25.3kD.
Recombinant Human CHRNB3 is produced by our Mammalian expression system and the target gene encoding Ile25-Leu232 is expressed with a 6His tag at the C-terminus. Neuronal acetylcholine receptor subunit beta-3(CHRNB3) is a cell membrane protein and belongs to the ligand-gated ion channel (TC 1.A.9) family. CHRNB3 seems to be composed of two different type of subunits: alpha and beta. The CHRNB3 are (hetero) pentamers composed of homologous subunits. The subunits that make up the muscle and neuronal forms of CHRNB3 are encoded by separate genes and have different primary structure. There are several subtypes of neuronal CHRNB3 that vary based on which homologous subunits are arranged around the central channel. They are classified as alpha-subunits if like muscle alpha-1, they have a pair of adjacent cysteines as part of the presumed acetylcholine binding site. Subunits lacking these cysteine residues are classified as beta-subunits.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell junction, Cell membrane |
| BioGrid: | 107564. 3 interactions. |
|
There are currently no product reviews
|















.png)







