Recombinant Human NGFRAP1/BEX3(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :40kD.
Recombinant Human NGFRAP1 is produced by our Mammalian expression system and the target gene encoding Met1-Pro111 is expressed with a Fc tag at the C-terminus. NGFRAP1, also called BEX3, can encode protein BEX3. BEX3 shuttles between the cytoplasm and the nucleus, and it associates with replicating mitochondria. BEX3 interacts with 14-3-3 epsilon(YWHAE) or DIABLO/SMAC to function as a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Many disease, such as neuronal death and neurogenetic diseases, is closely related to the BEX3.
MW :40kD.
Recombinant Human NGFRAP1 is produced by our Mammalian expression system and the target gene encoding Met1-Pro111 is expressed with a Fc tag at the C-terminus. NGFRAP1, also called BEX3, can encode protein BEX3. BEX3 shuttles between the cytoplasm and the nucleus, and it associates with replicating mitochondria. BEX3 interacts with 14-3-3 epsilon(YWHAE) or DIABLO/SMAC to function as a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Many disease, such as neuronal death and neurogenetic diseases, is closely related to the BEX3.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm |
| Post transnational modification: | Ubiquitinated. Degraded by the proteasome (By similarity). |
| Tissue Specificity: | Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver. |
| BioGrid: | 117956. 19 interactions. |
|
There are currently no product reviews
|










.png)











