Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag)
Fig. 1: SDS-PAGE analysis of Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag) under reducing and non-reducing conditions.
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL&DYKDDDDKSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI |
Source: Human cells.
MW :34.4kD.
Recombinant Human Human NKG2A & CD94 Heterodimer is produced by our Mammalian expression system and the target gene encoding Arg100-Leu233 & Ser34-Ile179 is expressedwith a 8His & Flag tag at the N-terminus NKG2-A/NKG2-B Type II Integral Membrane Protein contains 1 C-type lectin domain and belongs to the killer cell lectin-like receptor family. The killer cell lectin-like receptor family is a group of transmembrane proteins preferentially expressed in NK cells. Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. CD94 (Cluster of Differentiation 94), also known as killer cell lectin-like receptor subfamily D member 1 (KLRD1), is expressed on the surface of natural killer cells in the innate immune system. CD94 Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. CD94 Can form disulfide-bonded heterodimer with NKG2 family members. The CD94/NKG2 complex, on the surface of natural killer cells interacts with Human Leukocyte Antigen (HLA)-E on target cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Natural killer cells. |
| BioGrid: | 110020. 3 interactions. |
|
There are currently no product reviews
|









.png)










