Recombinant Human Nucleobindin-2/Nesfatin-1
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 10mM Sodium Phosphate,pH6.5. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL |
Source: E.coli.
MW :9.6kD.
Recombinant Human Nucleobindin-2 is produced by our E.coli expression system and the target gene encoding Val25-Leu106 is expressed. Nesfatin-1 is a metabolic polypeptide encoded in the N-terminal region of the precursor protein, Nucleobindin2 (NUCB2). Nesfatin-1 is a neuropeptide produced in the hypothalamus of mammals. It participates in the regulation of hunger and fat storage. Nesfatin-1 is also expressed in other areas of the brain, and in pancreatic islets beta-cells, gastric endocrine cells and adipocytes. Nesfatin-1 suppresses food intake and can regulate energy metabolism in a Leptin independent manner. Nesfatin-1 may also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.
MW :9.6kD.
Recombinant Human Nucleobindin-2 is produced by our E.coli expression system and the target gene encoding Val25-Leu106 is expressed. Nesfatin-1 is a metabolic polypeptide encoded in the N-terminal region of the precursor protein, Nucleobindin2 (NUCB2). Nesfatin-1 is a neuropeptide produced in the hypothalamus of mammals. It participates in the regulation of hunger and fat storage. Nesfatin-1 is also expressed in other areas of the brain, and in pancreatic islets beta-cells, gastric endocrine cells and adipocytes. Nesfatin-1 suppresses food intake and can regulate energy metabolism in a Leptin independent manner. Nesfatin-1 may also exert hypertensive roles and modulate blood pressure through directly acting on peripheral arterial resistance.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Tissue Specificity: | Predominantly expressed in spleen, testis and normal stomach. |
BioGrid: | 110979. 29 interactions. |
There are currently no product reviews
|