Recombinant Human Parkinson Juvenile Disease Protein 2/PARK2 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,2mM DTT,20% Glycerol,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTKLEHHHHHH |
Source: E.coli.
MW :43.4kD.
Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus. E3 Ubiquitin-Protein Ligase Parkin (PARK2) belongs to the RBR family and Parkin subfamily. PARK2 is expressed in the heart, testis, skeletal muscle, with high expression levels found in the brain including the substantianigra. PARK2 is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. The mutations of gene encoding this protein will result in Parkinson disease and autosomal recessive juvenile Parkinson disease.
MW :43.4kD.
Recombinant Human Parkinson Juvenile Disease Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Lys387 is expressed with a 6His tag at the C-terminus. E3 Ubiquitin-Protein Ligase Parkin (PARK2) belongs to the RBR family and Parkin subfamily. PARK2 is expressed in the heart, testis, skeletal muscle, with high expression levels found in the brain including the substantianigra. PARK2 is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. The mutations of gene encoding this protein will result in Parkinson disease and autosomal recessive juvenile Parkinson disease.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus, Endoplasmic reticulum, Mitochondrion |
| Post transnational modification: | Phosphorylation at Ser-65 by PINK1 contributes to activate PRKN activity. It is however not sufficient and requires binding to phosphorylated ubiquitin as well. |
| Tissue Specificity: | Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis. Found in serum (at protein level). |
| BioGrid: | 111105. 422 interactions. |
|
There are currently no product reviews
|




















.png)











