Recombinant Human PDCD10/TFAR15
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 25mM TrisHCl,pH7.3. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GSHMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA |
Source: E. coli.
MW :24.9kD.
Recombinant Human Programmed Cell Death Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Ala212 is expressed. Programmed Cell Death Protein 10 (PDCD10) belongs to the PDCD10 family. PDCD10 exists as a homodimer and is widely expressed. PDCD10 can increase mitogen-activated protein kinase activity and MST4 activity. PDCD10 is required for normal cardiovascular development and normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3.
MW :24.9kD.
Recombinant Human Programmed Cell Death Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Ala212 is expressed. Programmed Cell Death Protein 10 (PDCD10) belongs to the PDCD10 family. PDCD10 exists as a homodimer and is widely expressed. PDCD10 can increase mitogen-activated protein kinase activity and MST4 activity. PDCD10 is required for normal cardiovascular development and normal angiogenesis, vasculogenesis and hematopoiesis during embryonic development. Defects in PDCD10 are the cause of cerebral cavernous malformations type 3.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Golgi apparatus membrane, Cell membrane |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 116400. 60 interactions. |
|
There are currently no product reviews
|












.png)








