Recombinant Human Phosphatidylinositol Transfer Protein a Isoform/PITPNA (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 1mM EDTA, 1mM DTT, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
Source: E.coli.
MW :34kD.
Recombinant Human PITPNA is produced by our E.coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus. Phosphatidylinositol Transfer Protein a Isoform (PITPNA) is found in the cytoplasm and belongs to the PtdIns transfer protein family. PITPNA is a ubiquitous and highly conserved protein in multicellular eukaryotes that catalyzes the exchange of phospholipids between membranes and participates in cellular phospholipid metabolism, signal transduction and vesicular trafficking in vivo. It is expressed in a wide range of tissues and implicated in phospholipase C signaling and in the production of phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) by phosphoinositide-3-kinase.
MW :34kD.
Recombinant Human PITPNA is produced by our E.coli expression system and the target gene encoding Met1-Asp270 is expressed with a 6His tag at the N-terminus. Phosphatidylinositol Transfer Protein a Isoform (PITPNA) is found in the cytoplasm and belongs to the PtdIns transfer protein family. PITPNA is a ubiquitous and highly conserved protein in multicellular eukaryotes that catalyzes the exchange of phospholipids between membranes and participates in cellular phospholipid metabolism, signal transduction and vesicular trafficking in vivo. It is expressed in a wide range of tissues and implicated in phospholipase C signaling and in the production of phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) by phosphoinositide-3-kinase.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Expressed in a wide range of tissues. |
| BioGrid: | 111323. 25 interactions. |
|
There are currently no product reviews
|














.png)








