Recombinant Human Phosphoserine Phosphatase/PSP (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 50mM Tris, 250mM NaCl, 50mM Imidazole, pH 8.5 . |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEELEHHHHHH |
Source: E.coli.
MW :26.07kD.
Recombinant Human Phosphoserine Phosphatase is produced by our E.coli expression system and the target gene encoding Met1-Glu225 is expressed with a 6His tag at the C-terminus. Phosphoserine phosphatase (PSP) is an enzyme that belongs to the serB family. PSPH catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. Deficiency of this protein is thought to be linked to Williams syndrome. A disorder that results in pre- and postnatal growth retardation, moderate psychomotor retardation and facial features suggestive of Williams syndrome.
MW :26.07kD.
Recombinant Human Phosphoserine Phosphatase is produced by our E.coli expression system and the target gene encoding Met1-Glu225 is expressed with a 6His tag at the C-terminus. Phosphoserine phosphatase (PSP) is an enzyme that belongs to the serB family. PSPH catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. Deficiency of this protein is thought to be linked to Williams syndrome. A disorder that results in pre- and postnatal growth retardation, moderate psychomotor retardation and facial features suggestive of Williams syndrome.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
BioGrid: | 111695. 11 interactions. |
There are currently no product reviews
|