Recombinant Human Prefoldin Subunit 2/PFDN2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 50mM NaCl, 1mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS |
Source: E.coli.
MW :18.8kD.
Recombinant Human Prefoldin Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 2 (PFDN2) belongs to the Prefoldin Beta subunit family. The PFDN2 protein is one of six subunits of Prefoldin that act as a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly. PFDN2 binds specifically to Cytosolic Chaperonin (c-CPN) and transfers target proteins to it. PFDN2 also binds to a nascent polypeptide chain and promotes folding in settings where there are many competing pathways for non-native proteins.
MW :18.8kD.
Recombinant Human Prefoldin Subunit 2 is produced by our E.coli expression system and the target gene encoding Met1-Ser154 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 2 (PFDN2) belongs to the Prefoldin Beta subunit family. The PFDN2 protein is one of six subunits of Prefoldin that act as a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly. PFDN2 binds specifically to Cytosolic Chaperonin (c-CPN) and transfers target proteins to it. PFDN2 also binds to a nascent polypeptide chain and promotes folding in settings where there are many competing pathways for non-native proteins.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Mitochondrion |
| BioGrid: | 111224. 90 interactions. |
|
There are currently no product reviews
|








.png)








