Recombinant Human Prefoldin Subunit 4/PFDN4 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES |
Source: E.coli.
MW :17.48kD.
Recombinant Human Prefoldin Subunit 4 is produced by our E.coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 4 (PFDN4) is a heterohexameric chaperone protein that belongs to the prefoldin subunit beta family. The complex of PFDN4, consisting of two PFD-alpha type and four PFD-beta type subunits, forms a double beta barrel assembly with six protruding coiled-coils. PFDN4 binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly.
MW :17.48kD.
Recombinant Human Prefoldin Subunit 4 is produced by our E.coli expression system and the target gene encoding Met1-Ser134 is expressed with a 6His tag at the N-terminus. Prefoldin Subunit 4 (PFDN4) is a heterohexameric chaperone protein that belongs to the prefoldin subunit beta family. The complex of PFDN4, consisting of two PFD-alpha type and four PFD-beta type subunits, forms a double beta barrel assembly with six protruding coiled-coils. PFDN4 binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Mitochondrion |
| BioGrid: | 111225. 65 interactions. |
|
There are currently no product reviews
|











.png)











