Recombinant Human Pro-Neuropeptide Y/NPY (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWVDHHHHHH |
Source: Human Cells.
MW :9.1kD.
Recombinant Human Pro-Neuropeptide Y is produced by our Mammalian expression system and the target gene encoding Tyr29-Trp97 is expressed with a 6His tag at the C-terminus. Pro-Neuropeptide Y (NPY) is a member of the NPY family. NPY is a secreted protein and is one of the most abundant peptides in the nervous system. It also can be found in some chromaffin cells of the adrenal medulla. NPY can be cleaved into Neuropeptide Y and C-flanking peptide of NPY chain, which regulates energy usage, and it is involved in learning, memory processing, and epilepsy. NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. In addition, NPY increases the proportion of energy stored as fat and blocks nociceptive signals to the brain.
MW :9.1kD.
Recombinant Human Pro-Neuropeptide Y is produced by our Mammalian expression system and the target gene encoding Tyr29-Trp97 is expressed with a 6His tag at the C-terminus. Pro-Neuropeptide Y (NPY) is a member of the NPY family. NPY is a secreted protein and is one of the most abundant peptides in the nervous system. It also can be found in some chromaffin cells of the adrenal medulla. NPY can be cleaved into Neuropeptide Y and C-flanking peptide of NPY chain, which regulates energy usage, and it is involved in learning, memory processing, and epilepsy. NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. In addition, NPY increases the proportion of energy stored as fat and blocks nociceptive signals to the brain.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The neuropeptide Y form is cleaved at Pro-30 by the prolyl endopeptidase FAP (seprase) activity (in vitro). |
| Tissue Specificity: | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
| BioGrid: | 110914. 7 interactions. |
|
There are currently no product reviews
|









.png)








