Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQVDHHHHHH |
Source: Human Cells.
MW :16.04kD.
Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus. Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.
MW :16.04kD.
Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus. Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. Significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues. Expressed in epididymis (at protein level). |
| BioGrid: | 125610. 8 interactions. |
|
There are currently no product reviews
|











.png)









