Recombinant Human Protein ZMYND10/BLU (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGDLELLLPGEAEVLVRGLRSFPLREMGSEGWNQQHENLEKLNMQAILDATVSQGEPIQELLVTHGKVPTLVEELIAVEMWKQKVFPVFCRVEDFKPQNTFPIYMVVHHEASIINLLETVFFHKEVCESAEDTVLDLVDYCHRKLTLLVAQSGCGGPPEGEGSQDSNPMQELQKQAELMEFEIALKALSVLRYITDCVDSLSLSTLSRMLSTHNLPCLLVELLEHSPWSRREGGKLQQFEGSRWHTVAPSEQQKLSKLDGQVWIALYNLLLSPEAQARYCLTSFAKGRLLKLRAFLTDTLLDQLPNLAHLQSFLAHLTLTETQPPKKDLVLEQIPEIWERLERENRGKWQAIAKHQLQHVFSPSEQDLRLQARRWAETYRLDVLEAVAPERPRCAYCSAEASKRCSRCQNEWYCCRECQVKHWEKHGKTCVLAAQGDRAKLEHHHHHH |
Source: E.coli.
MW :51.41kD.
Recombinant Human Protein Zinc Finger MYND Domain-Containing Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Lys440 is expressed with a 6His tag at the C-terminus. Zinc Finger MYND Domain-Containing Protein 10 (ZMYND10) is a cytoplasmic protein. ZMYND10 contains one MYND-type zinc finger. It has alternative splicing activity and forms two different proteins. ZMYND10 posses the metal-binding activity, which can binds with zinc ion. It is reported that ZMYND10 can functionally suppress tumor formation in vivo and is, therefore, likely to be one of the candidate tumor suppressor genes involved in NPC.
MW :51.41kD.
Recombinant Human Protein Zinc Finger MYND Domain-Containing Protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Lys440 is expressed with a 6His tag at the C-terminus. Zinc Finger MYND Domain-Containing Protein 10 (ZMYND10) is a cytoplasmic protein. ZMYND10 contains one MYND-type zinc finger. It has alternative splicing activity and forms two different proteins. ZMYND10 posses the metal-binding activity, which can binds with zinc ion. It is reported that ZMYND10 can functionally suppress tumor formation in vivo and is, therefore, likely to be one of the candidate tumor suppressor genes involved in NPC.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cytoplasm |
| BioGrid: | 119499. 10 interactions. |
|
There are currently no product reviews
|















.png)











