Recombinant Human Repulsive Guidance Molecule A/RGMA (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPG |
Source: E. coli.
MW :29.8kD.
Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus. Repulsive guidance molecule A(RGMA) is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.
MW :29.8kD.
Recombinant Human Repulsive guidance molecule A is produced by our E.coli expression system and the target gene encoding Pro169-Gly422 is expressed with a 6His tag at the N-terminus. Repulsive guidance molecule A(RGMA) is a cell membrane protein and belongs to the repulsive guidance molecule (RGM) family. It interacts with NEO1, BMP2 and BMP4. RGMA is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. It helps guide Retinal Ganglion Cell (RGC) axons to the tectum in the midbrain. RGMa has been implicated to play an important role in the developing brain and in the scar tissue that forms after a brain injury. This protein may also function as a tumor suppressor in some cancers.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Autocatalytically cleaved at low pH; the two chains remain linked via two disulfide bonds. |
| BioGrid: | 121284. 14 interactions. |
|
There are currently no product reviews
|















.png)










