Recombinant Human Ribonuclease Pancreatic/RNASE1 (C-6His)

Product code: 32-7760

Shipping Info:

Order now and get it on Tuesday November 11, 2025

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $319.00 

  • $573.00 

Add to Wish List

Shipping Info:

Order now and get it on Tuesday November 11, 2025

Same day delivery FREE on San Diego area orders placed by 1.00 PM


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH
Gene : RNASE1
Gene ID : 6035
Uniprot ID : P07998

Source: Human Cells.
MW :15.6kD.
Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus. Ribonuclease Pancreatic is a secreted enzyme that belongs to the pancreatic ribonuclease family. RNASE1 is an endonuclease that cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. RNASE1 prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. RNASE1 acts on single stranded and double stranded RNA.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: N-linked glycans are of complex type.
Tissue Specificity: Pancreas and other tissues and body fluids (indicating it may have other physiological functions besides its role in digestion).
BioGrid: 111964. 5 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products