Recombinant Human Ribonuclease Pancreatic/RNASE1 (C-6His)

Figure: Coomassie gel staining. RNASE1 (10 ug) was loaded in 4-20% SDS Page gel in reducing condition.
Roll over image to zoom in
Shipping Info:
Order now and get it on Friday May 02, 2025
Same day delivery FREE on San Diego area orders placed by 1.00 PM
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH |
Source: Human Cells.
MW :15.6kD.
Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus. Ribonuclease Pancreatic is a secreted enzyme that belongs to the pancreatic ribonuclease family. RNASE1 is an endonuclease that cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. RNASE1 prefers poly(C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. RNASE1 acts on single stranded and double stranded RNA.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | N-linked glycans are of complex type. |
Tissue Specificity: | Pancreas and other tissues and body fluids (indicating it may have other physiological functions besides its role in digestion). |
BioGrid: | 111964. 5 interactions. |
There are currently no product reviews
|