Recombinant Human S100-A2(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GMMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Source: E. coli.
MW :11.2kD.
Recombinant Human Protein S100-A2 is produced by our E.coli expression system and the target gene encoding Met1-Pro98 is expressed. The calcium-binding Protein S100-A2 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100-A2 was first detected in lung and kidney, and is mainly expressed in a subset of tissues and cells such as breast epithelia and liver. The S100A2 protein is a homodimer that undergoes a conformational change upon binding of calcium, and the active form functions in regulating cell proliferation and differentiation, gene transcription, and p53-dependent growth arrest and apoptosis. This protein is regarded as a putative tumor suppressor, and thus chromosomal rearrangements and reduced expression of S100A2 gene have been implicated in certain carcinomas.
MW :11.2kD.
Recombinant Human Protein S100-A2 is produced by our E.coli expression system and the target gene encoding Met1-Pro98 is expressed. The calcium-binding Protein S100-A2 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100-A2 was first detected in lung and kidney, and is mainly expressed in a subset of tissues and cells such as breast epithelia and liver. The S100A2 protein is a homodimer that undergoes a conformational change upon binding of calcium, and the active form functions in regulating cell proliferation and differentiation, gene transcription, and p53-dependent growth arrest and apoptosis. This protein is regarded as a putative tumor suppressor, and thus chromosomal rearrangements and reduced expression of S100A2 gene have been implicated in certain carcinomas.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Tissue Specificity: | A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes. |
| BioGrid: | 112181. 13 interactions. |
|
There are currently no product reviews
|











.png)










