Recombinant Human S100 Calcium Binding Protein A9/S100A9/MRP14
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP |
Source: E.coli.
MW :13.2kD.
Recombinant Human S100 Calcium Binding Protein A9 is produced by our E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Protein S100-A9 (also MRP14 and calgranulin B)is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response.It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Cytoplasm, Cytoplasm, Cell membrane |
| Post transnational modification: | Phosphorylated. Phosphorylation inhibits activation of tubulin polymerization. |
| BioGrid: | 112188. 114 interactions. |
|
There are currently no product reviews
|












.png)








