Recombinant Human S100A7
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
Source: E. coli.
MW :11.5kD.
Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed. S100A7 is a 11-12 kDa member of the S100 family of EF hand calcium binding proteins. Human S100A7 shares 32% amino acid sequence identity with mouse S100A7A, the closest related protein in mouse. It is acetylated at the N-terminus and binds both calcium and zinc ions. S100A7 is up-regulated in keratinocytes of psoriasis and atopic dermatitis lesions, as well as in epithelial cells of the tongue, eye, and female genital tract. Its up-regulation can be induced by bacterial exposure, inflammatory cytokines, or epidermal barrier disruption. S100A7 supports epithelial integrity through killing E. coli by sequestration of zinc and through inducing the up-regulation of tight junction proteins. The interaction of S100A7 with RAGE promotes the migration of immune cells and the infiltration of macrophages into tumor sites.
MW :11.5kD.
Recombinant Human S100A7 is produced by our E.coli expression system and the target gene encoding Met1-Gln101 is expressed. S100A7 is a 11-12 kDa member of the S100 family of EF hand calcium binding proteins. Human S100A7 shares 32% amino acid sequence identity with mouse S100A7A, the closest related protein in mouse. It is acetylated at the N-terminus and binds both calcium and zinc ions. S100A7 is up-regulated in keratinocytes of psoriasis and atopic dermatitis lesions, as well as in epithelial cells of the tongue, eye, and female genital tract. Its up-regulation can be induced by bacterial exposure, inflammatory cytokines, or epidermal barrier disruption. S100A7 supports epithelial integrity through killing E. coli by sequestration of zinc and through inducing the up-regulation of tight junction proteins. The interaction of S100A7 with RAGE promotes the migration of immune cells and the infiltration of macrophages into tumor sites.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Secreted |
| Tissue Specificity: | Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients. |
| BioGrid: | 112186. 60 interactions. |
|
There are currently no product reviews
|















.png)







