Recombinant Human Secretagoginn/SCGN (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLHKVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDADSSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILALQENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINPVDHHHHHH |
Source: Human Cells.
MW :33.08kD.
Recombinant Human Secretagogin is produced by our Mammalian expression system and the target gene encoding Met1-Pro276 is expressed with a 6His tag at the C-terminus. Secretagogin (SCGN) is a secreted calcium-binding protein that is found in the cytoplasm; a small proportion is associated with secretory granules and membrane fractions. SCGN contains six EF-hand domains, related to calbindin D-28K and calretinin. SCGN is thought to be involved in KCL-stimulated calcium flux and cell proliferation SCGN can be detected in human serum after ischemic neuronal damage. SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication.
MW :33.08kD.
Recombinant Human Secretagogin is produced by our Mammalian expression system and the target gene encoding Met1-Pro276 is expressed with a 6His tag at the C-terminus. Secretagogin (SCGN) is a secreted calcium-binding protein that is found in the cytoplasm; a small proportion is associated with secretory granules and membrane fractions. SCGN contains six EF-hand domains, related to calbindin D-28K and calretinin. SCGN is thought to be involved in KCL-stimulated calcium flux and cell proliferation SCGN can be detected in human serum after ischemic neuronal damage. SCGN may function to negatively control growth and differentiation rates and, thus, indirectly inhibit cell replication.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Secreted, Cytoplasmic vesicle |
| Tissue Specificity: | Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons. |
| BioGrid: | 115839. 22 interactions. |
|
There are currently no product reviews
|










.png)










