Recombinant Human Serum Amyloid A4/SAA4 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 200mM NaCl, 0.5mM EDTA, 20% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKYLEHHHHHH |
Source: E. coli.
MW :14kD.
Recombinant Human Serum Amyloid A4 Protein is produced by our E.coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus. Serum Amyloid A-4 Protein (SAA4) is a member of the SAA family. SAA proteins are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma. SAA4 is constitutively expressed only in humans and mice. Its physiological function is unknown. SAA4 functions as a major acute phase reactant. SAA4 mRNA and protein occurrence in macrophage derived foam cells of coronary and carotid arteries implied a specific role of human SAA4 during inflammation including atherosclerosis.
MW :14kD.
Recombinant Human Serum Amyloid A4 Protein is produced by our E.coli expression system and the target gene encoding Glu19-Thr130 is expressed with a 6His tag at the C-terminus. Serum Amyloid A-4 Protein (SAA4) is a member of the SAA family. SAA proteins are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma. SAA4 is constitutively expressed only in humans and mice. Its physiological function is unknown. SAA4 functions as a major acute phase reactant. SAA4 mRNA and protein occurrence in macrophage derived foam cells of coronary and carotid arteries implied a specific role of human SAA4 during inflammation including atherosclerosis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Expressed by the liver; secreted in plasma. |
| BioGrid: | 112199. 1 interactions. |
|
There are currently no product reviews
|












.png)








