Recombinant Human Sialidase-1/NEU-1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH |
Source: Human Cells.
MW :41.27kD.
Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus. Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), beta-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.
MW :41.27kD.
Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus. Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), beta-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome membrane, Lysosome lumen, Cell membrane, Cytoplasmic vesicle |
| Post transnational modification: | Phosphorylation of tyrosine within the internalization signal results in inhibition of sialidase internalization and blockage on the plasma membrane. |
| Tissue Specificity: | Highly expressed in pancreas, followed by skeletal muscle, kidney, placenta, heart, lung and liver. Weakly expressed in brain. |
| BioGrid: | 110831. 13 interactions. |
|
There are currently no product reviews
|












.png)







