Recombinant Human ST6 Sialyltransferase 2/ST6GalNAc2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | SAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR |
Source: Human Cells.
MW :38.84kD.
Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus. Alpha-N-Acetylgalactosaminide a-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen.
MW :38.84kD.
Recombinant Human ST6GalNAc2 is produced by our Mammalian expression system and the target gene encoding Ser29-Arg374 is expressed with a 6His tag at the C-terminus. Alpha-N-Acetylgalactosaminide a-2,6-Sialyltransferase 2 (ST6GALNAC2) belongs to the glycosyltransferase 29 family that adds sialic acids to the non-reducing ends of glycoconjugates. At the cell surface, these modifications play roles in cell-cell and cell-substrate interactions, bacterial adhesion and protein targeting. ST6GALNAC2 is localized to the Golgi apparatus membrane. ST6GALNAC2 is highly expressed in lactating mammary glands and the adult testis; it is expressed at lower levels in the kidney. ST6GALNAC2 can catalyze 2,6-sialylation of the Tn antigen.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Golgi apparatus membrane |
| Tissue Specificity: | Expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. |
| BioGrid: | 115856. 1 interactions. |
|
There are currently no product reviews
|















.png)











