Recombinant Human Sulfotransferase 1C2/SULT1C2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 0.1M NaCl, pH 8.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MNHKVHHHHHHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL |
Source: E. coli.
MW :36.3kD.
Recombinant Human Sulfotransferase 1C2 is produced by our E.coli expression system and the target gene encoding Met1-Leu296 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1C2 (SULT1C2) is a cytosolic enzyme member of the Sulfotransferase 1 family. Human SULT1C2 is primarily expressed in the adult stomach, kidney and thyroid gland, and in the fetal kidney and liver. SULT1C2 catalyzes the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT1C2 may be involved in the activation of carcinogenic hyroxylamines. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).
MW :36.3kD.
Recombinant Human Sulfotransferase 1C2 is produced by our E.coli expression system and the target gene encoding Met1-Leu296 is expressed with a 6His tag at the N-terminus. Sulfotransferase 1C2 (SULT1C2) is a cytosolic enzyme member of the Sulfotransferase 1 family. Human SULT1C2 is primarily expressed in the adult stomach, kidney and thyroid gland, and in the fetal kidney and liver. SULT1C2 catalyzes the sulfate conjugation of drugs, xenobiotic compounds, hormones, and neurotransmitters. SULT1C2 may be involved in the activation of carcinogenic hyroxylamines. It shows activity towards p-nitrophenol and N-hydroxy-2-acetylamino-fluorene (N-OH-2AAF).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver. |
| BioGrid: | 112688. 10 interactions. |
|
There are currently no product reviews
|













.png)










