Recombinant Human Testin/TES (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMSLEHHHHHH |
Source: E.coli.
MW :49.1kD.
Recombinant Human Testin is produced by our E.coli expression system and the target gene encoding Met1-Ser421 is expressed with a 6His tag at the C-terminus. Testin belongs to the prickle/espinas/testin family. Testin contains three LIM zinc-binding domains and one PET domain, TES as a scaffold protein that may have a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. In addition, TES can also as a tumor suppressor, inhibits tumor cell growth, regulate the cell proliferation.TES interacts with many cytoskeletal proteins, such as Zyxin, Mena, Actin, Talin and VASP. The ability of TES to associate with alpha-actin, Zyxin and paxillin is dependent on the conformational state of the molecule.
MW :49.1kD.
Recombinant Human Testin is produced by our E.coli expression system and the target gene encoding Met1-Ser421 is expressed with a 6His tag at the C-terminus. Testin belongs to the prickle/espinas/testin family. Testin contains three LIM zinc-binding domains and one PET domain, TES as a scaffold protein that may have a role in cell adhesion, cell spreading and in the reorganization of the actin cytoskeleton. In addition, TES can also as a tumor suppressor, inhibits tumor cell growth, regulate the cell proliferation.TES interacts with many cytoskeletal proteins, such as Zyxin, Mena, Actin, Talin and VASP. The ability of TES to associate with alpha-actin, Zyxin and paxillin is dependent on the conformational state of the molecule.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cell junction |
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 117572. 58 interactions. |
|
There are currently no product reviews
|












.png)











