Recombinant Human Tissue Factor Pathway Inhibitor 2/TFPI-2/PP5/REF-1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | DAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTGCGGNDNNFVSREDCKRACAKALKVDHHHHHH |
Source: Human Cells.
MW :22.88kD.
Recombinant Human Tissue Factor Pathway Inhibitor 2 is produced by our Mammalian expression system and the target gene encoding Asp23-Lys213 is expressed with a 6His tag at the C-terminus. Human Tissue Factor Pathway Inhibitor 2 (TFPI2) has a N-terminal acidic region, three Kunita domains separated with by two linker regions, and a C-terminal basic region. TFPI2 has the function of regulating plasmin-mediated matrix remodeling, inhibits trypsin, plasmin, factor Vlla/tissue factor and weakly factor Xa.. TFPI2 has no effect on thrombin. TFPI2 may contribute to tumor progression in many cancers; in these cancers, the expression of TFPI2 can be down-regulated.
MW :22.88kD.
Recombinant Human Tissue Factor Pathway Inhibitor 2 is produced by our Mammalian expression system and the target gene encoding Asp23-Lys213 is expressed with a 6His tag at the C-terminus. Human Tissue Factor Pathway Inhibitor 2 (TFPI2) has a N-terminal acidic region, three Kunita domains separated with by two linker regions, and a C-terminal basic region. TFPI2 has the function of regulating plasmin-mediated matrix remodeling, inhibits trypsin, plasmin, factor Vlla/tissue factor and weakly factor Xa.. TFPI2 has no effect on thrombin. TFPI2 may contribute to tumor progression in many cancers; in these cancers, the expression of TFPI2 can be down-regulated.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Umbilical vein endothelial cells, liver, placenta, heart, pancreas, and maternal serum at advanced pregnancy. |
| BioGrid: | 113693. 33 interactions. |
|
There are currently no product reviews
|










.png)











