Recombinant Human Transcriptional Repressor CTCF/CTCF
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMI |
Source: E. coli.
MW :16.9kD.
Recombinant Human CCCTC-Binding Factor is produced by our E.coli expression system and the target gene encoding Met1-Ile154 is expressed. Transcriptional Repressor CTCF (CTCF) belongs to the CTCF Zinc-Finger Protein family. CTCF contains twelve C2H2-type zinc fingers and interacts with CHD8. CTCF is widely expressed in many tissues, and it is absent in primary spermatocytes. CTCF is involved in transcriptional regulation by binding to chromatin insulators and preventing interaction between promoter and nearby enhancers and silencers. CTCF plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription. In addition, CTCF is also indispensable in the epigenetic regulation and chromatin remodeling.
MW :16.9kD.
Recombinant Human CCCTC-Binding Factor is produced by our E.coli expression system and the target gene encoding Met1-Ile154 is expressed. Transcriptional Repressor CTCF (CTCF) belongs to the CTCF Zinc-Finger Protein family. CTCF contains twelve C2H2-type zinc fingers and interacts with CHD8. CTCF is widely expressed in many tissues, and it is absent in primary spermatocytes. CTCF is involved in transcriptional regulation by binding to chromatin insulators and preventing interaction between promoter and nearby enhancers and silencers. CTCF plays an essential role in oocyte and preimplantation embryo development by activating or repressing transcription. In addition, CTCF is also indispensable in the epigenetic regulation and chromatin remodeling.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Chromosome, Chromosome |
| Post transnational modification: | Sumoylated on Lys-74 and Lys-689; sumoylation of CTCF contributes to the repressive function of CTCF on the MYC P2 promoter. |
| Tissue Specificity: | Ubiquitous. Absent in primary spermatocytes. |
| BioGrid: | 115906. 55 interactions. |
|
There are currently no product reviews
|











.png)








