Recombinant Human Transforming Growth Factor a/TGFa(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 10mM Acetic Acid . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV |
Source: E.coli.
MW :5.55kD.
Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system and the target gene encoding Val41-Val90 is expressed. Transforming Growth Factor a (TGF-a) belongs to the EGF family of cytokines. It is a mitogenic polypeptide and secreted protein, which is expressed by monocytes, keratinocytes, and various tumor cells. TGFa contains two chains, protransforming growth factor a and transforming growth factor a. It can bind to the EGF receptor that synergistically with TGF beta to stimulate anchorage-independent cell proliferation and produce a mitogenic response. TGFa interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.
MW :5.55kD.
Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system and the target gene encoding Val41-Val90 is expressed. Transforming Growth Factor a (TGF-a) belongs to the EGF family of cytokines. It is a mitogenic polypeptide and secreted protein, which is expressed by monocytes, keratinocytes, and various tumor cells. TGFa contains two chains, protransforming growth factor a and transforming growth factor a. It can bind to the EGF receptor that synergistically with TGF beta to stimulate anchorage-independent cell proliferation and produce a mitogenic response. TGFa interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines. |
| BioGrid: | 112897. 68 interactions. |
|
There are currently no product reviews
|











.png)










