Recombinant Human Trefoil Factor 2/TFF2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH |
Source: Human Cells.
MW :13kD.
Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus. Trefoil Factor 2 (TFF2) is a member of the trefoil family and contains two P-type (trefoil) domains. Members of this family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF2 is a secreted protein and specifically expressed in the stomach. TFF2 inhibits gastrointestinal motility and gastric acid secretion. TFF2 could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
MW :13kD.
Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus. Trefoil Factor 2 (TFF2) is a member of the trefoil family and contains two P-type (trefoil) domains. Members of this family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF2 is a secreted protein and specifically expressed in the stomach. TFF2 inhibits gastrointestinal motility and gastric acid secretion. TFF2 could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Stomach. |
| BioGrid: | 112890. 1 interactions. |
|
There are currently no product reviews
|














.png)








