Recombinant Human Tryptase beta-2/TPSB2 (C-6His)

Product code: 32-7457

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $420.00 

  • $699.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : APAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKPVDHHHHHH
Gene : TPSB2
Gene ID : 64499
Uniprot ID : P20231
Source: Human Cells.
MW :29.64kD.
Recombinant Human Tryptase beta-2 is produced by our Mammalian expression system and the target gene encoding Ala19-Pro275 is expressed with a 6His tag at the C-terminus. Tryptases are Trypsin-like Serine Proteases. beta-Tryptases are the main isoenzymes in mast cells. b tryptases form active tetramers with heparin proteoglycan. In the tetramer, the unique arrangement of the active sites facing a narrow central pore, beta-Tryptases are resistant to macromolecule protease inhibitors . When mast cells are activated, beta-Tryptases are released and participate in provoking inflammatory conditions . beta-Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic disorders.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 122201. 16 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products