Recombinant Human TWEAK Receptor/TWEAK R/TNFRSF12A (C-Fc)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :35.6kD.
Recombinant Human TWEAK Receptor is produced by our Mammalian expression system and the target gene encoding Glu28-Trp79 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 12A(TNFRSF12A) is also known as Fibroblast growth factor-inducible immediate-early response protein 14, FN14, CD266 antigen and tweak-receptor. TNFRSF12A is a single-pass type I membrane protein, including a 27 aa signal peptide, a 53 aa extracellular domain, a 21 aa transmembrane domain and a 28 aa cytoplasmic domain. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A can be induced by FGF1 and phorbol ester. TNFRSF12A binds to TWEAK/TNFSF12A to initiate a signal transduction cascade, causing different cellular responses such as cell death, cell proliferation, and angiogenesis.
MW :35.6kD.
Recombinant Human TWEAK Receptor is produced by our Mammalian expression system and the target gene encoding Glu28-Trp79 is expressed with a Fc tag at the C-terminus. Tumor necrosis factor receptor superfamily member 12A(TNFRSF12A) is also known as Fibroblast growth factor-inducible immediate-early response protein 14, FN14, CD266 antigen and tweak-receptor. TNFRSF12A is a single-pass type I membrane protein, including a 27 aa signal peptide, a 53 aa extracellular domain, a 21 aa transmembrane domain and a 28 aa cytoplasmic domain. TNFRSF12A is highly expressed in heart, placenta and kidney. TNFRSF12A can be induced by FGF1 and phorbol ester. TNFRSF12A binds to TWEAK/TNFSF12A to initiate a signal transduction cascade, causing different cellular responses such as cell death, cell proliferation, and angiogenesis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas. |
| BioGrid: | 119478. 4 interactions. |
|
There are currently no product reviews
|








.png)








