Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MRGSHHHHHHGSMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Source: E. coli.
MW :23.3kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a 179 amino acid enzyme that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2C is highly expressed in tumor tissues and at low levels in most adult normal tissues. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. UBE2C accepts Ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. It acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), which has E3 ubiquitin ligase activity, and targets for destruction substrates from the preceding mitosis (Cyclin A, Cyclin B, Securin, Geminin).
MW :23.3kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a 179 amino acid enzyme that belongs to the Ubiquitin-Conjugating Enzyme family. UBE2C is highly expressed in tumor tissues and at low levels in most adult normal tissues. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. UBE2C accepts Ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. It acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), which has E3 ubiquitin ligase activity, and targets for destruction substrates from the preceding mitosis (Cyclin A, Cyclin B, Securin, Geminin).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed. |
| BioGrid: | 116249. 65 interactions. |
|
There are currently no product reviews
|

















.png)








