Recombinant Human Ubiquitin-Conjugating Enzyme E2 C/UBE2C/UBCH10 (N-6His, T7 tag)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSHMASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Source: E. coli.
MW :23.3kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His, T7 tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a member of the ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. UBE2C acts as an essential factor of the anaphase, promotes complex/cyclosome (APC/C) controls progression through mitosis.
MW :23.3kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 C is produced by our E.coli expression system and the target gene encoding Met1-Pro179 is expressed with a 6His, T7 tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 C (UBE2C) is a member of the ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. UBE2C is required for the destruction of mitotic cyclins and for cell cycle progression. It accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. UBE2C acts as an essential factor of the anaphase, promotes complex/cyclosome (APC/C) controls progression through mitosis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed. |
| BioGrid: | 116249. 65 interactions. |
|
There are currently no product reviews
|













.png)











