Recombinant Human Ubiquitin-Conjugating Enzyme E2 H/UBE2H (N-GST)

Product code: 32-7163

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $304.00 

  • $348.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 50mM HEPES, 150mM NaCl, 2mM DTT, 10% Glycerol, pH 7.5.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
Gene : UBE2H
Gene ID : 7328
Uniprot ID : P62256
Source: E.coli.
MW :47kD.
Recombinant Human Ubiquitin-Conjugating Enzyme E2 H is produced by our E.coli expression system and the target gene encoding Met1-Leu183 is expressed with a GST tag at the N-terminus. Ubiquitin-Conjugating Enzyme E2 H (UBE2H) belongs to the E2 Ubiquitin-Conjugating Enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. It has been shown to conjugate ubiquitin to histone H2A in an E3 dependent manner in vitro. UBE2H is the human homolog to the yeast DNA repair gene RAD6, which is induced by DNA damaging reagents. UBE2H has been associated with cancer-induced cachexia and with the regulation of sepsis-induced muscle proteolysis.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Post transnational modification: Autoubiquitinated in vitro in the presence of NEDD4L.
BioGrid: 113176. 88 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products