Recombinant Human Unique Cartilage Matrix-Associated Protein/UCMA
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
Source: E. coli.
MW :9.76kD.
Recombinant Human Unique cartilage matrix-associated protein is produced by our E.coli expression system and the target gene encoding Ser65-Thr138 is expressed. C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
MW :9.76kD.
Recombinant Human Unique cartilage matrix-associated protein is produced by our E.coli expression system and the target gene encoding Ser65-Thr138 is expressed. C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Sulfated on tyrosine residues. |
| Tissue Specificity: | Predominantly expressed in resting chondrocytes. |
| BioGrid: | 128678. 1 interactions. |
|
There are currently no product reviews
|

















.png)











