Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Immune-Check Point
        • Kits and Reagents
          • Luciferase reporter assay kits
          • Inhibitor Screening Kit
          • ELISA Kits
          • Molecular Biology Kits
          • Apoptosis Detection kits
          • Flowcytometry staining kits
          • Cell dissociation solutions
          • Western Blot membranes (Quick blots/ Q Blots)
        • Tissue Microarray
        • recmAb™
          • Recombinant Biosimilar Antibodies
          • Recombinant Rabbit Antibodies
          • Recombinant Mouse Antibodies
    • Pathways
        • All-Pathways

          View all pathways

        • interactive-pathways

          View all interactive pathways

    • Custom Service
      • Drug Discovery Screening Services
      • Stable Cell Line Development
      • Protein Production
      • Custom Antibody Development
    • Quick order
      • + Add More..

    • Support
    • Contact us
    • Distributors
    1. Catalog
    2. /
    3. Recombinant Proteins
    4. /
    5. Recombinant Human VEGF-A/VEGF165

    Recombinant Human VEGF-A/VEGF165

    Share:

    Recombinant Human VEGF-A/VEGF165

    Roll over image to zoom in

       

    Product code: 32-7071

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual
    Write a review for this product on BioCompare
    Get $20 gift card from Amazon
    Size
    Price

    Available Pack Size(s)

    •   10 µg

    •  50 µg

    • $319.00 

    • $573.00  $458.40 

    Add to Wish List

    Bulk Order

    Shipping Info:

    For estimated delivery dates, please contact us at support@abeomics.com

    Download TDS / Manual

    • Product Info
    • Description
    • Application Note
    • More
    • Review   (0)
    Amount : 50 µg
    Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
    Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
    AA sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
    Gene : VEGFA
    Gene ID : 7422
    Uniprot ID : P15692

    Source: Human Cells.
    MW :19.1kD.
    Recombinant Human Vascular Endothelial Growth Factor A is produced by our Mammalian expression system and the target gene encoding Ala27-Arg191 is expressed. Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator in vasculogenesis and angiogenesis both physiologically and pathologically. VEGF-A has 8 differently spliced isoforms, of which VEGF165 is the most abundant one. VEGF165 is a disulfide-linked homodimer consisting of two glycosylated 165 amino acid polypeptide chains. VEGF stimulates the cellular response through binding to tyrosine kinase receptors VEGFR1 and VEGFR2 on the cell surface. It is widely accepted that VEGFR2 mediate almost all of the known cellular responses to VEGF while the function of VEGFR1 is less defined and is thought to modulate the VEGFR2 signaling.

    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
    Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

    For Research Use Only. Not for use in diagnostic/therapeutics procedures.

    Subcellular location: Secreted
    Tissue Specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.
    BioGrid: 113265. 36 interactions.
    There are currently no product reviews
    Write a review on this product!

    Customers who purchased this product also purchased

    mCD73 Stable Cell Line

    mCD73 Stable Cell Line

    details-mCD73 Stable Cell Line
    oProlactin Recombinant Protein

    oProlactin Recombinant Protein

    details-oProlactin Recombinant Protein
    Anti-CD370 PE (Clone : 8F9)

    Anti-CD370 PE (Clone : 8F9)

    details-Anti-CD370 PE (Clone : 8F9)
    CpG ODN (1668), TLR9 ligand (Class B)

    CpG ODN (1668), TLR9 ligand (C...

    details-CpG ODN (1668), TLR9 ligand (Class B)
    Recombinant Human Nephrosis 2 Idiopathic Steroid-Resistant

    Recombinant Human Nephrosis 2 ...

    details-Recombinant Human Nephrosis 2 Idiopathic Steroid-Resistant
    Anti-CTLA-4 antibody(DM51), Rabbit mAb

    Anti-CTLA-4 antibody(DM51), Ra...

    details-Anti-CTLA-4 antibody(DM51), Rabbit mAb
    Mouse Monoclonal Antibody to PCNA (Clone : 4C10G3)(Discontinued)

    Mouse Monoclonal Antibody to P...

    details-Mouse Monoclonal Antibody to PCNA (Clone : 4C10G3)(Discontinued)
    Monoclonal antibody to CD244 (Clone: C1.7)

    Monoclonal antibody to CD244 (...

    details-Monoclonal antibody to CD244 (Clone: C1.7)
    Anti-CD123 antibody(DM34), Rabbit mAb

    Anti-CD123 antibody(DM34), Rab...

    details-Anti-CD123 antibody(DM34), Rabbit mAb
    Monoclonal Antibody to TREX1 (Clone: ABM2A85)

    Monoclonal Antibody to TREX1 (...

    details-Monoclonal Antibody to TREX1 (Clone: ABM2A85)
    Anti-Human TNF alpha (Adalimumab) – APC

    Anti-Human TNF alpha (Adalimum...

    details-Anti-Human TNF alpha (Adalimumab) – APC
    GPNMB HEK Recombinant Protein

    GPNMB HEK Recombinant Protein

    details-GPNMB HEK Recombinant Protein
    Monoclonal Antibody to mouse MCP-1, ECE-2

    Monoclonal Antibody to mouse M...

    details-Monoclonal Antibody to mouse MCP-1, ECE-2
    Monoclonal Antibody to Human sMD-2 and sMD-2/TLR4 (Clone : 4H1)

    Monoclonal Antibody to Human s...

    details-Monoclonal Antibody to Human sMD-2 and sMD-2/TLR4 (Clone : 4H1)

    Most viewed Products

    Recombinant Human Thioredoxin-Like 4A

    Recombinant Human Thioredoxin-Like ...

    details-Recombinant Human Thioredoxin-Like 4A
    Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

    Monoclonal Antibody to Human IL-1be...

    details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
    NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

    NF-kB Leeporter™ Luciferase Repor...

    details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
    Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

    Monoclonal antibody to Human PD-L1 ...

    details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
    Polyclonal Antibody to Beta actin

    Polyclonal Antibody to Beta actin

    details-Polyclonal Antibody to Beta actin
    Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

    Monoclonal Antibody to Caspase-3 (P...

    details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
    Monoclonal Antibody to GAPDH (Clone: ABM22C5)

    Monoclonal Antibody to GAPDH (Clone...

    details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
    Monoclonal antibody to B7-H4 (Clone: ABM53A6)

    Monoclonal antibody to B7-H4 (Clone...

    details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
    Polyclonal Antibody to Beta Tubulin

    Polyclonal Antibody to Beta Tubulin

    details-Polyclonal Antibody to Beta Tubulin
    Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Peroxidase conjugated Goat anti Mou...

    details-Peroxidase conjugated Goat anti Mouse IgG (H+L)

    Related Products

    Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4 (N-GST)

    Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4/UBE2D4 (N-GST)

    Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2

    Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2

    PTPN6 Recombinant Protein

    PTPN6 Recombinant Protein

    New Products

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    Recombinant Human Ephrin A Receptor 4/EphA4 (C-6His)

    close

    Please Login to write a Review !!


    close

    Recombinant Human VEGF-A/VEGF165

    Product code: 32-7071
    *specify in mg or ml

    Abeomics Logo

    Antibodies & Engineered Cell Lines™

    Tel : 858-263-4982

    Fax : 858-247-7052

    Email : support@abeomics.com

    Connect with Us

    • Facebook
    • Twitter
    • Linkedin
    • YouTube

    Products

    • Antibodies
    • Cell Lines
    • Ligands and Inhibitors
    • Recombinant Proteins
    • Immune-Check Point
    • Kits and Reagents
    • Tissue Microarray
    • recmAb™

    Services

    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development

    Quick order

    + Add More..

    Newsletter

    Posters and Flyers

    © 2022 Abeomics. All rights reserved.
    • Blog
    • Sitemap
    • Terms
    • Privacy Policy
    • Legal
    • Email unsubscribe

    Item added to cart successfully

    No cart item available
    Continue shopping View Cart