Abeomics Logo
  • (0) Items
    • Items | total: $0.00 (0)
    • Your shopping cart is empty!

Abeomics Logo

Antibodies & Engineered Cell Lines™

  • Account
    • Login
    • Address Book
    • My Order
    • My Wish List
    • Open a New Ticket
  • (0) Items
    • Your shopping cart is empty!

  • About us
  • Products
      • Antibodies
        • Biosimilars
        • TLR and Innate Immunity
        • Apoptosis
        • Immunology
        • DNA methylation and Repair
        • Cell Signalling
        • Infectious Diseases
        • NF-kB Pathway
        • Cancer Marker
        • Loading Controls
        • Stem Cells
        • Development and Differentiation
        • Isotype Controls
        • Secondary Antibodies
        • Tag Antibodies
        • Miscellaneous
      • Cell Lines
        • Reporter Cell Lines
        • Stable Cell Lines
      • Ligands and Inhibitors
        • Peptide Inhibitors
        • Proteases inhibitors
        • TLR Ligands
        • Caspase Inhibitors
      • Recombinant Proteins
        • Recombinant Proteins
      • Immune-Check Point
      • Kits and Reagents
        • Other Kits
        • Luciferase reporter assay kits
        • Inhibitor Screening Kit
        • ELISA Kits
        • Molecular Biology Kits
        • Apoptosis Detection kits
        • Flowcytometry staining kits
        • Cell dissociation solutions
        • Western Blot membranes (Quick blots/ Q Blots)
      • Tissue Microarray
      • recmAb™
        • Recombinant Biosimilar Antibodies
        • Recombinant Rabbit Antibodies
        • Recombinant Mouse Antibodies
      • sdMAB ™
        • Shark sdMAB ™
        • Alpaca sdMAB ™
  • Pathways
      • All-Pathways

        View all pathways

      • interactive-pathways

        View all interactive pathways

  • Custom Service
    • Drug Discovery Screening Services
    • Stable Cell Line Development
    • Protein Production
    • Custom Antibody Development
  • Quick order
    • + Add More..

  • Support
  • Contact us
  • Distributors
  1. Catalog
  2. /
  3. Recombinant Proteins
  4. /
  5. Recombinant Human VEGF-A/VEGF165

Recombinant Human VEGF-A/VEGF165

Share:

Recombinant Human VEGF-A/VEGF165

Roll over image to zoom in

   

Product code: 32-7071

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual
Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $376.00 

  • $642.00 

Add to Wish List

Bulk Order

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Download TDS / Manual

  • Product Info
  • Description
  • Application Note
  • More
  • Review   (0)
Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Gene : VEGFA
Gene ID : 7422
Uniprot ID : P15692

Source: Human Cells.
MW :19.1kD.
Recombinant Human Vascular Endothelial Growth Factor A is produced by our Mammalian expression system and the target gene encoding Ala27-Arg191 is expressed. Human Vascular endothelial growth factor (VEGF), also known as VEGF-A and vascular permeability factor (VPF), belongs to the platelet-derived growth factor family of cysteine-knot growth factors. It is a potent activator in vasculogenesis and angiogenesis both physiologically and pathologically. VEGF-A has 8 differently spliced isoforms, of which VEGF165 is the most abundant one. VEGF165 is a disulfide-linked homodimer consisting of two glycosylated 165 amino acid polypeptide chains. VEGF stimulates the cellular response through binding to tyrosine kinase receptors VEGFR1 and VEGFR2 on the cell surface. It is widely accepted that VEGFR2 mediate almost all of the known cellular responses to VEGF while the function of VEGFR1 is less defined and is thought to modulate the VEGFR2 signaling.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Tissue Specificity: Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. A higher level expression seen in pituitary tumors as compared to the pituitary gland.
BioGrid: 113265. 36 interactions.
There are currently no product reviews
Write a review on this product!

Customers who purchased this product also purchased

Anti-Human TNF alpha (Adalimumab) – Fc Muted™

Anti-Human TNF alpha (Adalimum...

details-Anti-Human TNF alpha (Adalimumab) – Fc Muted™
Polyclonal Antibody to  Gamma-Catenin Antibody

Polyclonal Antibody to Gamma-...

details-Polyclonal Antibody to  Gamma-Catenin Antibody
Recombinant human IFNGR1 protein with C-terminal human Fc tag

Recombinant human IFNGR1 prote...

details-Recombinant human IFNGR1 protein with C-terminal human Fc tag
Z-D(OMe)E(OMe)VD(OMe)-FMK (Caspase 3, 7 Inhibitor)

Z-D(OMe)E(OMe)VD(OMe)-FMK (Cas...

details-Z-D(OMe)E(OMe)VD(OMe)-FMK (Caspase 3, 7 Inhibitor)
SIGLEC5 Stable Cell Line

SIGLEC5 Stable Cell Line

details-SIGLEC5 Stable Cell Line
Anti-Human TNF alpha (Adalimumab) – APC

Anti-Human TNF alpha (Adalimum...

details-Anti-Human TNF alpha (Adalimumab) – APC
Recombinant human CD48 protein with C-terminal human Fc

Recombinant human CD48 protein...

details-Recombinant human CD48 protein with C-terminal human Fc
Recombinant human CXCL12 protein with C-terminal human Fc tag

Recombinant human CXCL12 prote...

details-Recombinant human CXCL12 protein with C-terminal human Fc tag
Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9

Recombinant Human Proprotein C...

details-Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 9
MAPK1 His Recombinant Protein

MAPK1 His Recombinant Protein

details-MAPK1 His Recombinant Protein
Recombinant human ITGB5 protein with C-terminal human Fc tag

Recombinant human ITGB5 protei...

details-Recombinant human ITGB5 protein with C-terminal human Fc tag
Monoclonal Antibody to mouse M-CSF

Monoclonal Antibody to mouse M...

details-Monoclonal Antibody to mouse M-CSF
Anti-p63 Monoclonal Antibody (Clone:IHC063)

Anti-p63 Monoclonal Antibody (...

details-Anti-p63 Monoclonal Antibody (Clone:IHC063)
Recombinant human SELP protein with C-terminal human Fc tag

Recombinant human SELP protein...

details-Recombinant human SELP protein with C-terminal human Fc tag

Most viewed Products

Recombinant Human Thioredoxin-Like 4A

Recombinant Human Thioredoxin-Like ...

details-Recombinant Human Thioredoxin-Like 4A
NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line

NF-kB Leeporter™ Luciferase Repor...

details-NF-kB Leeporter™ Luciferase Reporter-RAW264.7 Cell Line
Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)

Monoclonal Antibody to Caspase-3 (P...

details-Monoclonal Antibody to Caspase-3 (Pro and Active) (Clone: ABM1C12)
Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)

Monoclonal Antibody to Human IL-1be...

details-Monoclonal Antibody to Human IL-1beta (Clone: ABM26G5)
Polyclonal Antibody to Beta actin

Polyclonal Antibody to Beta actin

details-Polyclonal Antibody to Beta actin
Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)

Monoclonal antibody to Human PD-L1 ...

details-Monoclonal antibody to Human PD-L1 (Clone: ABM5F25)
Monoclonal Antibody to GAPDH (Clone: ABM22C5)

Monoclonal Antibody to GAPDH (Clone...

details-Monoclonal Antibody to GAPDH (Clone: ABM22C5)
Monoclonal antibody to B7-H4 (Clone: ABM53A6)

Monoclonal antibody to B7-H4 (Clone...

details-Monoclonal antibody to B7-H4 (Clone: ABM53A6)
Polyclonal Antibody to Beta Tubulin

Polyclonal Antibody to Beta Tubulin

details-Polyclonal Antibody to Beta Tubulin
Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Recombinant Human Indoleamine 2,3-D...

details-Recombinant Human Indoleamine 2,3-Dioxygenase/IDO/INDO (N-6His)

Related Products

HUS1 Recombinant Protein

HUS1 Recombinant Protein

Recombinant Human LAMP1/CD107a (C-Fc)(Discontinued)

Recombinant Human LAMP1/CD107a (C-Fc)(Discontinued)

Recombinant human MMP11 protein with C-terminal human Fc tag

Recombinant human MMP11 protein with C-terminal human Fc tag

New Products

Human APP Protein, His Tag

Human APP Protein, His Tag

Anti-Biotin Mab(1D4-C5)

Anti-Biotin Mab(1D4-C5)

Human APLP2 Protein, His Tag

Human APLP2 Protein, His Tag

close

Please Login to write a Review !!


close

Recombinant Human VEGF-A/VEGF165

Product code: 32-7071
*specify in mg or ml

Abeomics Logo

Antibodies & Engineered Cell Lines™

Tel : 858-263-4982

Fax : 858-247-7052

Email : support@abeomics.com

Connect with Us

  • Facebook
  • Twitter
  • Linkedin
  • YouTube

Products

  • Antibodies
  • Cell Lines
  • Ligands and Inhibitors
  • Recombinant Proteins
  • Immune-Check Point
  • Kits and Reagents
  • Tissue Microarray
  • recmAb™
  • sdMAB ™

Services

  • Drug Discovery Screening Services
  • Stable Cell Line Development
  • Protein Production
  • Custom Antibody Development

Quick order

+ Add More..

Newsletter

Posters and Flyers

© 2023 Abeomics. All rights reserved.
  • Blog
  • Sitemap
  • Terms
  • Privacy Policy
  • Legal
  • Email unsubscribe

Item added to cart successfully

No cart item available
Continue shopping View Cart