Recombinant Human WW Domain-Binding Protein 2/WBP2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA |
Source: E.coli.
MW :13.38kD.
Recombinant Human WW Domain-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ala100 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 2 (WBP2) is a ubiquitous protein that contains one GRAM domain. The WW domain is composed of 38 to 40 semi-conserved AA shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is participated in mediating protein-protein interactions. WBP2 binds to the WW domain of YAP1, WWP1 and WWP2. The WW-binding 1 motif of WBP2 mediates interaction with NEDD4. The function of this protein WBP2 has not been determined. Some researches demonstrate that WBP-2 also interacts with the thyroid-specific transcription factor Pax8.
MW :13.38kD.
Recombinant Human WW Domain-Binding Protein 2 is produced by our E.coli expression system and the target gene encoding Met1-Ala100 is expressed with a 6His tag at the N-terminus. WW Domain-Binding Protein 2 (WBP2) is a ubiquitous protein that contains one GRAM domain. The WW domain is composed of 38 to 40 semi-conserved AA shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is participated in mediating protein-protein interactions. WBP2 binds to the WW domain of YAP1, WWP1 and WWP2. The WW-binding 1 motif of WBP2 mediates interaction with NEDD4. The function of this protein WBP2 has not been determined. Some researches demonstrate that WBP-2 also interacts with the thyroid-specific transcription factor Pax8.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Tissue Specificity: | Ubiquitous. |
| BioGrid: | 117102. 19 interactions. |
|
There are currently no product reviews
|












.png)








