Recombinant Human Zinc Finger Protein 100/ZNF100 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, 1mM ZnCl2, 30% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMRHEMVAKPPVICSHFPQDLWAEQDIKDSFQEAILKKYGKYGHDNLQLQKGCKSVDECKVHKEHDNKLNQCLITTQSNIFQCDPSAKVFHTFSNSNRHKIRHTRKKPFK |
Source: E.coli.
MW :15kD.
Recombinant Human Zinc Finger Protein 100 is produced by our E.coli expression system and the target gene encoding Met1-Lys109 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 100 (ZNF100) is part of the krueppel C2H2-type zinc-finger protein family. ZNF100 contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 is a DNA-binding protein domain consisting of zinc fingers. Zinc finger protein 100 occurs in nature as the part of transcription factors conferring DNA sequence specificity as the DNA-binding domain. Zinc finger proteins have also found use in protein engineering due to their modularity and have prospects as components of tools for use in therapeutic gene modulation and zinc finger nucleases.
MW :15kD.
Recombinant Human Zinc Finger Protein 100 is produced by our E.coli expression system and the target gene encoding Met1-Lys109 is expressed with a 6His tag at the N-terminus. Zinc Finger Protein 100 (ZNF100) is part of the krueppel C2H2-type zinc-finger protein family. ZNF100 contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZNF100 is a DNA-binding protein domain consisting of zinc fingers. Zinc finger protein 100 occurs in nature as the part of transcription factors conferring DNA sequence specificity as the DNA-binding domain. Zinc finger proteins have also found use in protein engineering due to their modularity and have prospects as components of tools for use in therapeutic gene modulation and zinc finger nucleases.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 127858. 5 interactions. |
|
There are currently no product reviews
|

















.png)








