Recombinant Mouse B7-2/ CD86 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKHHHHHH |
Source: Human cells.
MW :25.9kD.
Recombinant Mouse T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Val24-Lys244 is expressed with a 6His tag at the C-terminus. T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members are transmembrane cell surface molecules that play important roles in immune activation and the maintenance of immune tolerance. Mouse CD86 shares 59% and 81% aa sequence identity with human and rat CD86, respectively. It contains 1 Ig-like C2-type domainand 1 Ig-like V-type domain. It is highly expressed on activated antigen presenting cells. CD86 involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.
MW :25.9kD.
Recombinant Mouse T-lymphocyte Activation Antigen CD86 is produced by our Mammalian expression system and the target gene encoding Val24-Lys244 is expressed with a 6His tag at the C-terminus. T-lymphocyte activation antigen CD86 (B7-2) is a glycosylated protein in the B7 family. B7 family members are transmembrane cell surface molecules that play important roles in immune activation and the maintenance of immune tolerance. Mouse CD86 shares 59% and 81% aa sequence identity with human and rat CD86, respectively. It contains 1 Ig-like C2-type domainand 1 Ig-like V-type domain. It is highly expressed on activated antigen presenting cells. CD86 involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Polyubiquitinated; which is promoted by MARCH8 and results in endocytosis and lysosomal degradation. |
| Tissue Specificity: | Expressed on activated B-cells. |
| BioGrid: | 198617. 1 interactions. |
|
There are currently no product reviews
|












.png)







