Recombinant Mouse C-C motif Chemokine 8/CCL8/MCP-2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQPHHHHHH |
Source: Human Cells.
MW :9.8kD.
Recombinant Mouse C-C motif Chemokine 8 is produced by our expression system and the target gene encoding Glu20-Pro97 is expressed Chemokine ligand 8 (CCL8,MCP-2), is a small secreted cytokine which belongs to the intercrine beta (chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions to activate different immune cells, including mast cells, eosinophils and basophils which are involved in allergic responses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its ability achieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B and CCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is one of the major co-receptors for HIV-1.
MW :9.8kD.
Recombinant Mouse C-C motif Chemokine 8 is produced by our expression system and the target gene encoding Glu20-Pro97 is expressed Chemokine ligand 8 (CCL8,MCP-2), is a small secreted cytokine which belongs to the intercrine beta (chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions to activate different immune cells, including mast cells, eosinophils and basophils which are involved in allergic responses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its ability achieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B and CCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is one of the major co-receptors for HIV-1.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|


















.png)











