Recombinant Mouse C-X-C Motif Chemokine 1/CXCL1/GRO a (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH |
Source: Human Cells.
MW :9.4kD.
Recombinant Mouse C-X-C motif chemokine 1 is produced by our Mammalian expression system and the target gene encoding Arg20-Lys96 is expressed with a 6His tag at the C-terminus. Cxcl1, also called Gro, Gro1, Mgsa or Scyb1, is short for growth-regulated alpha protein. The protein belongs to the intercrine alpha (chemokine CxC) family. The N-terminal processed form KC(5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation.
MW :9.4kD.
Recombinant Mouse C-X-C motif chemokine 1 is produced by our Mammalian expression system and the target gene encoding Arg20-Lys96 is expressed with a 6His tag at the C-terminus. Cxcl1, also called Gro, Gro1, Mgsa or Scyb1, is short for growth-regulated alpha protein. The protein belongs to the intercrine alpha (chemokine CxC) family. The N-terminal processed form KC(5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | The N-terminal processed form KC(5-72) is produced by proteolytic cleavage after secretion from bone marrow stromal cells. |
|
There are currently no product reviews
|
















.png)







