Recombinant Mouse Cathepsin E/CTSE (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPVDHHHHHH |
Source: Human Cells.
MW :37kD.
Recombinant Mouse Cathepsin E is produced by our Mammalian expression system and the target gene encoding Ser60-Pro397 is expressed with a 6His tag at the C-terminus. Cathepsin E is encoded by the ctse gene, exists in the homodimer forms, belongs to the peptidase A1 family. Cathepsin E high expressed in the stomach, clara cells and alveolar macrophages of lung, brain microglia, spleen and activated B-lymphocytes. Cathepsin E may involve in the processing of antigenic peptides during MHC class II-mediated antigen presentation, play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
MW :37kD.
Recombinant Mouse Cathepsin E is produced by our Mammalian expression system and the target gene encoding Ser60-Pro397 is expressed with a 6His tag at the C-terminus. Cathepsin E is encoded by the ctse gene, exists in the homodimer forms, belongs to the peptidase A1 family. Cathepsin E high expressed in the stomach, clara cells and alveolar macrophages of lung, brain microglia, spleen and activated B-lymphocytes. Cathepsin E may involve in the processing of antigenic peptides during MHC class II-mediated antigen presentation, play a role in activation-induced lymphocyte depletion in the thymus, and in neuronal degeneration and glial cell activation in the brain.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endosome |
| Post transnational modification: | Glycosylated. The nature of the carbohydrate chain varies between cell types. In fibroblasts, the proenzyme contains a high mannose-type oligosaccharide, while the mature enzyme contains a complex-type oligosaccharide. |
| Tissue Specificity: | Expressed abundantly in the stomach, Clara cells and alveolar macrophages of the lung, brain microglia, spleen and activated B-lymphocytes. Not expressed in resting B-lymphocytes. |
|
There are currently no product reviews
|










.png)










