Recombinant Mouse Cathepsin H/CTSH (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACASCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQVVDHHHHHH |
Source: Human Cells.
MW :36.1kD.
Recombinant Mouse Cathepsin H is produced by our Mammalian expression system and the target gene encoding Glu22-Val333 is expressed with a 6His tag at the C-terminus. Cathepsin H (CTSH), which can act both as an aminopeptidase and as an endopeptidase, is a lysosomal cysteine protease of the papain family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is associated with various pathological conditions like human fibrous meningioma, colorectal cancer, arthritis, human prostate tumor and lung cancer. CTSH is associated with cancer progression because of their ability to degrade extracellular matrices facilitating invasion, angiogenesis and metastasis as is evident from numerous clinical reports and experimental models. The expression of CTSH is significantly increased in disease states such as in prostate tumors, sera of asthmatic patients, and mucosa of colorectal cancer patients.
MW :36.1kD.
Recombinant Mouse Cathepsin H is produced by our Mammalian expression system and the target gene encoding Glu22-Val333 is expressed with a 6His tag at the C-terminus. Cathepsin H (CTSH), which can act both as an aminopeptidase and as an endopeptidase, is a lysosomal cysteine protease of the papain family. CTSH is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. CTSH is associated with various pathological conditions like human fibrous meningioma, colorectal cancer, arthritis, human prostate tumor and lung cancer. CTSH is associated with cancer progression because of their ability to degrade extracellular matrices facilitating invasion, angiogenesis and metastasis as is evident from numerous clinical reports and experimental models. The expression of CTSH is significantly increased in disease states such as in prostate tumors, sera of asthmatic patients, and mucosa of colorectal cancer patients.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome |
| Tissue Specificity: | Widely expressed with highest expression found in non-skeletal tissues. Low levels found in skeletal tissue. |
|
There are currently no product reviews
|
















.png)







