Recombinant Mouse CD5/Leu-1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCSSSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTSSQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGSWGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAPNGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEALCDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNKRVFVTCQDPNVDHHHHHH |
Source: Human Cells.
MW :38.9kD.
Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus. CD5 is a transmembrane glycoprotein of the conserved scavenger receptor cysteine-rich (SRCR) superfamily and expressed on thymocytes, peripheral T cells and a subset of B cells (B1-a). Moreover, CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. The long cytoplasmic tail of CD5 has no intrinsic enzymatic activity, but contains four tyrosine phosphorylation sites, including an immunoreceptor tyrosine-based (ITAM)-like motif (pseudo-ITAM) and an immunoreceptor tyrosine-based inhibitory (ITIM)-like motif (pseudo-ITIM), as well as multiple potential serine and threonine phosphorylation sites. It physically associates with the T cell antigen receptor (TCR) and B cell antigen receptor (BCR), where it negatively modulates the activation and differentiation signals transduced by these receptors. CD5 also plays an important role in protection from activation-induced cell death and in the recognition of pathogen associated molecular patterns (PAMPS) present on fungal surfaces.
MW :38.9kD.
Recombinant Mouse CD5 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn370 is expressed with a 6His tag at the C-terminus. CD5 is a transmembrane glycoprotein of the conserved scavenger receptor cysteine-rich (SRCR) superfamily and expressed on thymocytes, peripheral T cells and a subset of B cells (B1-a). Moreover, CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. The long cytoplasmic tail of CD5 has no intrinsic enzymatic activity, but contains four tyrosine phosphorylation sites, including an immunoreceptor tyrosine-based (ITAM)-like motif (pseudo-ITAM) and an immunoreceptor tyrosine-based inhibitory (ITIM)-like motif (pseudo-ITIM), as well as multiple potential serine and threonine phosphorylation sites. It physically associates with the T cell antigen receptor (TCR) and B cell antigen receptor (BCR), where it negatively modulates the activation and differentiation signals transduced by these receptors. CD5 also plays an important role in protection from activation-induced cell death and in the recognition of pathogen associated molecular patterns (PAMPS) present on fungal surfaces.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on tyrosine residues by LYN; this creates binding sites for PTPN6/SHP-1. |
|
There are currently no product reviews
|











.png)







