Recombinant Mouse Cystatin 8/CST8 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMMMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF |
Source: E.coli.
MW :13.3kD.
Recombinant Mouse Cystatin-8 is produced by our expression system and the target gene encoding Met1-Phe98 is expressed with a 6His tag at the N-terminus. Cystatin-8 is a secreted protein which belongs to the cystatin family. It is Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium. It performs a specialized role during sperm development and maturation.
MW :13.3kD.
Recombinant Mouse Cystatin-8 is produced by our expression system and the target gene encoding Met1-Phe98 is expressed with a 6His tag at the N-terminus. Cystatin-8 is a secreted protein which belongs to the cystatin family. It is Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium. It performs a specialized role during sperm development and maturation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium. |
|
There are currently no product reviews
|















.png)











