Recombinant Mouse Fibrillin-1/Asprosin (N-8His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHSTNETDASDIQDGSEMEANVSLASWDVEKPASFAFNISHVSNKVRILELLPALTTLMNHNRYLIESGNEDGFFKINQKEGVSYLHFTKKNAVAGTYSLQISSTPLYKKKELNQLEDRYDKDYLSGELGDNLKMKIQILLH |
Source: Human Cells.
MW :16.9kD.
Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
MW :16.9kD.
Recombinant Mouse Fibrillin-1 is produced by our Mammalian expression system and the target gene encoding Ser2732-His2871 is expressed with a 8His tag at the N-terminus. Asprosin is a protein hormone that is produced by white adipose tissue in mammals (and potentially by other tissues), which is then transported to the liver and stimulates it to release glucose into the blood stream. In the liver asprosin activates rapid glucose release by a cAMP-dependent pathway. The glucose release by the liver into the blood stream is vital for brain function and survival during fasting. People with neonatal progeroid syndrome lack asprosin, while people with insulin resistance have it in abundance. In animal tests asprosin showed potential for treating type 2 diabetes. When antibodies targeting asprosin were injected into diabetic mice, blood glucose and insulin levels improved.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Fibrillin-1: Forms intermolecular disulfide bonds either with other fibrillin-1 molecules or with other components of the microfibrils. |
| Tissue Specificity: | Asprosin: Secreted by white adipose tissue (at protein level) (PubMed:27087445). Fibrillin-1: Strongly expressed during the first week of osteoblast differentiation (PubMed:24039232). |
|
There are currently no product reviews
|














.png)











