Recombinant Mouse GM-CSF/CSF2
Shipping Info:
For estimated delivery dates, please contact us at support@abeomics.com
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK |
Source: E.coli.
MW :14.2kD.
Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Ala18-Lys141 is expressed. Granulocyte-macrophage colony-stimulating factor is an enzyme that in mouse is encoded by the Csf2 gene, belongs to the GM-CSF family.CSF2 is a Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes
MW :14.2kD.
Recombinant Mouse Granulocyte-Macrophage Colony-Stimulating Factor is produced by our E.coli expression system and the target gene encoding Ala18-Lys141 is expressed. Granulocyte-macrophage colony-stimulating factor is an enzyme that in mouse is encoded by the Csf2 gene, belongs to the GM-CSF family.CSF2 is a Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
There are currently no product reviews
|