Recombinant Mouse IL-1 Receptor Type 1/IL-1R-1 (C-Fc)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFKIEGRDMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :64kD.
Recombinant Mouse Interleukin-1 receptor type 1 is produced by our Mammalian expression system and the target gene encoding Leu20-Lys338 is expressed with a Fc tag at the C-terminus. Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune and inflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 betabut not IL1ra, was identified. This Type I receptor complex appears to mediate all the known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does not transduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form of IL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or as the soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signaling Type I receptor complex.
MW :64kD.
Recombinant Mouse Interleukin-1 receptor type 1 is produced by our Mammalian expression system and the target gene encoding Leu20-Lys338 is expressed with a Fc tag at the C-terminus. Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptor family. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1 receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune and inflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor in the presence of IL1a or IL1 betabut not IL1ra, was identified. This Type I receptor complex appears to mediate all the known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does not transduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form of IL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or as the soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signaling Type I receptor complex.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane, Cell membrane, Secreted |
| Post transnational modification: | Rapidly phosphorylated on Tyr-499 in response to IL-1, which creates a SH2 binding site for the PI 3-kinase regulatory subunit PIK3R1. |
| Tissue Specificity: | Isoform 2 is expressed in various brain tissues. |
| BioGrid: | 200625. 6 interactions. |
|
There are currently no product reviews
|















.png)











